🔥 Summer Cookoff — Win $100 Gift CardJoin Free →

How can I make a dairy-free Taiwanese dish?

Taipei Scallion Pancakes are a perfect choice if you're looking for a dairy-free Taiwanese dish. This snack is vegan and takes about 60 minutes to prepare. With 295 calories and 6 grams of protein, it's a delicious and satisfying option.

Recommended recipe

Taipei Scallion Pancakes

Taipei Scallion Pancakes

60 min · 295 cal · 6g protein · Taiwanese

View Full Recipe
Taiwanese recipesdairy-freevegansnacksscallion pancakes

People also ask

Can I recommend a gluten-free salad option?How can I make a quick and healthy snack with eggs?quick lunch ideas for kids using only whole wheat bread, peanut butter, and jelly?What is a refreshing summer drink recipe?What is a healthy Vietnamese dish to try?what to make with canned tuna, whole wheat pasta, and tomatoeseasy breakfast ideas using only spinach eggs and feta cheeseWhat quick recipes can I prepare in 15 minutes?

More recipes

Slow Cooker Shepherds Pie

Slow Cooker Shepherds Pie

385 min · 480 cal

Avocado Corn Salad

Avocado Corn Salad

18 min · 220 cal

Overnight Greek Yogurt Chia Protein Pudding

Overnight Greek Yogurt Chia Protein Pudding

5 min · 340 cal

Blackberry Sage Infused Water

Blackberry Sage Infused Water

10 min · 14 cal