🔥 Summer Cookoff — Win $100 Gift CardJoin Free →

What is a delicious dairy-free drink to try?

The Malted Milkshake is a delicious dairy-free drink that you should try! While it is vegetarian, it provides a rich and creamy texture that mimics traditional milkshakes without the dairy. Perfect for a sweet treat any time of the day, you can indulge without guilt.

Recommended recipe

Malted Milkshake

Malted Milkshake

5 min · 465 cal · 10g protein · American

View Full Recipe
dairy-freemilkshakevegetariansweet treatdrinks

People also ask

How do I make a comforting shrimp and grits dish?What is a healthy Vietnamese dish to try?What are some quick and healthy breakfast options?What is a hearty one-pot Italian dish?What is a quick and easy vegan breakfast?What's a high-protein option for dinner?What is a quick dessert recipe for chocolate lovers?What is a hearty chicken bowl recipe?

More recipes

Orange Creamsicle Float

Orange Creamsicle Float

5 min · 350 cal

3 Ingredient Orange Sorbet

3 Ingredient Orange Sorbet

245 min · 140 cal

Grated Parmesan Crusted Potatoes

Grated Parmesan Crusted Potatoes

60 min · 320 cal

Shepherd Pie with Creamy Mashed Potato Topping

Shepherd Pie with Creamy Mashed Potato Topping

70 min · 530 cal